(data stored in SCRATCH zone)

EMBL: CP002399.PE576

CP002399.PE576       Location/Qualifiers
FT   CDS             complement(602743..603369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0580"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /note="KEGG: saq:Sare_4280 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06130"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ADU06130.1"
FT                   /translation="MLSLGRLHLITDTRPGRDPLAVLRAALPVAGAELVVQVRVEDDAT
FT                   DREAYELACRVTEACRPYGAQFLVNDRLHVALAVDAAGGHVGADDLPVAAARRVLGPDA
FT                   VLGATARGPVGARTAVDAGASYLGVGPCHVTTTKSGLPDPIGPEGIRAVAEAVSVPVIA
FT                   IGGVTAASVPALRAAGAYGVAVVGALSLAADPAHATAELLRALTC"
     MLSLGRLHLI TDTRPGRDPL AVLRAALPVA GAELVVQVRV EDDATDREAY ELACRVTEAC        60
     RPYGAQFLVN DRLHVALAVD AAGGHVGADD LPVAAARRVL GPDAVLGATA RGPVGARTAV       120
     DAGASYLGVG PCHVTTTKSG LPDPIGPEGI RAVAEAVSVP VIAIGGVTAA SVPALRAAGA       180
     YGVAVVGALS LAADPAHATA ELLRALTC                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page