(data stored in SCRATCH zone)

EMBL: CP002399.PE58

CP002399.PE58        Location/Qualifiers
FT   CDS             57506..58852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0058"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   stp:Strop_0025 carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05612"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADU05612.1"
FT                   /translation="MQKMIESLLVANRGEIARRIIRTGRRLGIRTIAVHSEADGALPFV
FT                   TEADEAVCVGPANPAQSYRNVEAILDAARSTGAQAIHPGYGFLSENADFARTVEGAGLI
FT                   WVGPGADAISAMGDKINARNLMAAAGVPVAPGTTEPASDLDAAVAAAAEIGYPVMVKAA
FT                   AGGGGMGMGVAADEAALRTEYDKVRAFAERMFGDGSVLIERYFPRVRHVEVQILGLADG
FT                   RVVALGERECSVQRRNQKLVEESPSPAVSPELRERFLAAAVRAGEAVNYRNAGTVECLL
FT                   DPSTQEFFFLEMNTRLQVEHPVTEYVYGVDLVEEQLRVASGLAPTFDPDALTPRGHAIE
FT                   LRINAEDPKRFLPGPGAITTWNEPSGTGVRVDSGYVAGNTVTPFYDSLMAKLILTGATR
FT                   EEAVERARAAVAQFEIAGPKCNLPFFAELLENPEFLSGDYDTGIVSRMR"
     MQKMIESLLV ANRGEIARRI IRTGRRLGIR TIAVHSEADG ALPFVTEADE AVCVGPANPA        60
     QSYRNVEAIL DAARSTGAQA IHPGYGFLSE NADFARTVEG AGLIWVGPGA DAISAMGDKI       120
     NARNLMAAAG VPVAPGTTEP ASDLDAAVAA AAEIGYPVMV KAAAGGGGMG MGVAADEAAL       180
     RTEYDKVRAF AERMFGDGSV LIERYFPRVR HVEVQILGLA DGRVVALGER ECSVQRRNQK       240
     LVEESPSPAV SPELRERFLA AAVRAGEAVN YRNAGTVECL LDPSTQEFFF LEMNTRLQVE       300
     HPVTEYVYGV DLVEEQLRVA SGLAPTFDPD ALTPRGHAIE LRINAEDPKR FLPGPGAITT       360
     WNEPSGTGVR VDSGYVAGNT VTPFYDSLMA KLILTGATRE EAVERARAAV AQFEIAGPKC       420
     NLPFFAELLE NPEFLSGDYD TGIVSRMR                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page