(data stored in SCRATCH zone)

EMBL: CP002399.PE598

CP002399.PE598       Location/Qualifiers
FT   CDS             complement(619762..620376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0602"
FT                   /product="ribosomal protein S5"
FT                   /note="KEGG: saq:Sare_4298 30S ribosomal protein S5;
FT                   TIGRFAM: ribosomal protein S5; PFAM: ribosomal protein S5
FT                   domain protein; Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06152"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADU06152.1"
FT                   /translation="MPGQQRRGGGSGGNEGGRRDNRREGGRGNAPVEKTPHLERVVAIN
FT                   RVAKVVKGGRRFSFTALVIVGDGDGTVGVGYGKAKEVPAAIAKGVEEAKKHFFKVPRIG
FT                   QSIPHPVTGEDAAGVVLLKPASAGTGVIAGGPVRAVLECAGIHDVLSKSLGSSNPINIV
FT                   HATVAALKGLESPEQVAARRGLPVEDVAPAAMLASRAGVAS"
     MPGQQRRGGG SGGNEGGRRD NRREGGRGNA PVEKTPHLER VVAINRVAKV VKGGRRFSFT        60
     ALVIVGDGDG TVGVGYGKAK EVPAAIAKGV EEAKKHFFKV PRIGQSIPHP VTGEDAAGVV       120
     LLKPASAGTG VIAGGPVRAV LECAGIHDVL SKSLGSSNPI NIVHATVAAL KGLESPEQVA       180
     ARRGLPVEDV APAAMLASRA GVAS                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page