(data stored in SCRATCH zone)

EMBL: CP002399.PE602

CP002399.PE602       Location/Qualifiers
FT   CDS             complement(621861..622046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0606"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: saq:Sare_4302 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06156"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ADU06156.1"
FT                   /translation="MAKKALILKAAAKPKFSVRAYTRCQRCGRPKAVYRKFGLCRVCIR
FT                   EMAHRGELPGVSKASW"
     MAKKALILKA AAKPKFSVRA YTRCQRCGRP KAVYRKFGLC RVCIREMAHR GELPGVSKAS        60
     W                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page