(data stored in SCRATCH zone)

EMBL: CP002399.PE607

CP002399.PE607       Location/Qualifiers
FT   CDS             complement(623673..623909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0611"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: saq:Sare_4307 50S ribosomal protein L29;
FT                   TIGRFAM: ribosomal protein L29; PFAM: ribosomal protein
FT                   L29; Protein of unknown function DUF2216"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06161"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADU06161.1"
FT                   /translation="MAAGVKPSELRELSEEELVTKLREAKAELFNLRVQAATGQLDNNR
FT                   RLQVIRREIARIYTIMRERELGLSAAPTEVTAS"
     MAAGVKPSEL RELSEEELVT KLREAKAELF NLRVQAATGQ LDNNRRLQVI RREIARIYTI        60
     MRERELGLSA APTEVTAS                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page