(data stored in SCRATCH zone)

EMBL: CP002399.PE612

CP002399.PE612       Location/Qualifiers
FT   CDS             complement(626009..626848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0616"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: saq:Sare_4312 50S ribosomal protein L2;
FT                   TIGRFAM: ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06166"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADU06166.1"
FT                   /translation="MAIRKYKPTTPGRRGSSVADFAEITRSTPEKSLLAPLPKKGGRNA
FT                   HGRITTRHHGGGHKRQYRLIDFKRVDKDGVPAKVAHIEYDPNRTARIALLHYADGEKRY
FT                   IIAPKDLKQGDRVESGPGADIKPGNNLPLRNIPVGTTIHNVELRPGGGAKLARSAGVGI
FT                   QLLGREGAYATLRMPSGEIRRVDVRCRASIGEIGNADQSNINWGKAGRMRWKGKRPTVR
FT                   GVAMNPVDHPHGGGEGKTSGGRHPVNPQGKPEGRTRRKGQPSDRLIVRRRYATRKRG"
     MAIRKYKPTT PGRRGSSVAD FAEITRSTPE KSLLAPLPKK GGRNAHGRIT TRHHGGGHKR        60
     QYRLIDFKRV DKDGVPAKVA HIEYDPNRTA RIALLHYADG EKRYIIAPKD LKQGDRVESG       120
     PGADIKPGNN LPLRNIPVGT TIHNVELRPG GGAKLARSAG VGIQLLGREG AYATLRMPSG       180
     EIRRVDVRCR ASIGEIGNAD QSNINWGKAG RMRWKGKRPT VRGVAMNPVD HPHGGGEGKT       240
     SGGRHPVNPQ GKPEGRTRRK GQPSDRLIVR RRYATRKRG                              279
//

If you have problems or comments...

PBIL Back to PBIL home page