(data stored in SCRATCH zone)

EMBL: CP002399.PE618

CP002399.PE618       Location/Qualifiers
FT   CDS             complement(630580..632676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0622"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: saq:Sare_4318 elongation factor G; TIGRFAM:
FT                   translation elongation factor G; small GTP-binding protein;
FT                   PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   elongation factor G domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06172"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADU06172.1"
FT                   /translation="MAAADALANVRNIGIMAHIDAGKTTTTERILFYTGITYKIGEVHE
FT                   GAAVMDWMEQEQERGITITSAATKCEWKGHTIQIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VYDGVAGVEPQTENVWRQADKYNVPRMCFVNKLDRTGADFFRCVQMMIDRLNATPLVLQ
FT                   IPIGAESDFIGVVDLVEMRALTWRGETQKGEDYAVEEIPADLADSAAEWREKLMETLAD
FT                   VDDSVMEKYLEGEEISVDEIKAAIRRSTIAGKANPVLTGTAFKNKGIQPMLDAVVAYLP
FT                   SPLDIPAIEGTATDGETPLQRKPSVSEPFSGLAFKIQTDKHLGKLTYVRIYSGTLESGS
FT                   QVINSTKDRKERIGKIYQMHANKREERSSAQAGDIIAVQGLKQTTTGDTLCDPANPVIL
FT                   ESMTFPEPVIEVAIEPKTKADQEKLSTAIQRLAEEDPTFRVKLDDQTGQTVISGMGELH
FT                   LDILVDRMRREFNVEANIGKPQVAYRETIRRKVEKVEYTHKKQTGGSGQYARVIISVEP
FT                   LPLGNDAPTYEFANAVTGGRIPREFIPSVDAGAQDAMQYGILAGFPLVGVKLTLVDGQY
FT                   HEVDSSEMAFKIAGSMAMKEAARKADPALLEPMMAVEVTTPEENMGDVIGDLNSRRGII
FT                   QAMEERSGARVVRALVPLSEMFGYVGDLRSKTQGRASYSMQFDSYAEVPNSVAKEIIAK
FT                   ATGE"
     MAAADALANV RNIGIMAHID AGKTTTTERI LFYTGITYKI GEVHEGAAVM DWMEQEQERG        60
     ITITSAATKC EWKGHTIQII DTPGHVDFTV EVERSLRVLD GAVAVYDGVA GVEPQTENVW       120
     RQADKYNVPR MCFVNKLDRT GADFFRCVQM MIDRLNATPL VLQIPIGAES DFIGVVDLVE       180
     MRALTWRGET QKGEDYAVEE IPADLADSAA EWREKLMETL ADVDDSVMEK YLEGEEISVD       240
     EIKAAIRRST IAGKANPVLT GTAFKNKGIQ PMLDAVVAYL PSPLDIPAIE GTATDGETPL       300
     QRKPSVSEPF SGLAFKIQTD KHLGKLTYVR IYSGTLESGS QVINSTKDRK ERIGKIYQMH       360
     ANKREERSSA QAGDIIAVQG LKQTTTGDTL CDPANPVILE SMTFPEPVIE VAIEPKTKAD       420
     QEKLSTAIQR LAEEDPTFRV KLDDQTGQTV ISGMGELHLD ILVDRMRREF NVEANIGKPQ       480
     VAYRETIRRK VEKVEYTHKK QTGGSGQYAR VIISVEPLPL GNDAPTYEFA NAVTGGRIPR       540
     EFIPSVDAGA QDAMQYGILA GFPLVGVKLT LVDGQYHEVD SSEMAFKIAG SMAMKEAARK       600
     ADPALLEPMM AVEVTTPEEN MGDVIGDLNS RRGIIQAMEE RSGARVVRAL VPLSEMFGYV       660
     GDLRSKTQGR ASYSMQFDSY AEVPNSVAKE IIAKATGE                               698
//

If you have problems or comments...

PBIL Back to PBIL home page