(data stored in SCRATCH zone)

EMBL: CP002399.PE621

CP002399.PE621       Location/Qualifiers
FT   CDS             complement(634099..634716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0625"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06175"
FT                   /inference="similar to AA sequence:KEGG:Strop_3929"
FT                   /protein_id="ADU06175.1"
FT                   /translation="MTEPAPPGGDQPRPGPYPPGSASAPAHQPGPYGAYPGSPPAHGGG
FT                   WPAPASVPGHGGWGPHGGPALPPPPAETPRPPKRVDAVPGTPFGVVHLDVPPVTSGLAI
FT                   GSLVAGIAAIGVSLLVLCFGLAGRDVGGAWAAGAFTVLGGLIGAGAVVAGLLARRQIRR
FT                   PAPPPSVRFTGAGLAVAGISCGAAGVLFGLIGLALALVVQIT"
     MTEPAPPGGD QPRPGPYPPG SASAPAHQPG PYGAYPGSPP AHGGGWPAPA SVPGHGGWGP        60
     HGGPALPPPP AETPRPPKRV DAVPGTPFGV VHLDVPPVTS GLAIGSLVAG IAAIGVSLLV       120
     LCFGLAGRDV GGAWAAGAFT VLGGLIGAGA VVAGLLARRQ IRRPAPPPSV RFTGAGLAVA       180
     GISCGAAGVL FGLIGLALAL VVQIT                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page