(data stored in SCRATCH zone)

EMBL: CP002399.PE650

CP002399.PE650       Location/Qualifiers
FT   CDS             663208..663654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0654"
FT                   /product="hypothetical protein"
FT                   /note="manually curated; KEGG: saq:Sare_4336 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06204"
FT                   /inference="similar to AA sequence:KEGG:Sare_4336"
FT                   /protein_id="ADU06204.1"
FT                   /translation="MANDHGRAVDQDHSRPANVDDTTVEALGELSKALETVHRVRGHLY
FT                   SAHQLVGGADLTLDRVVKLLREAGHDETADRVEHELLGRNLLPGRWTFQIMEEFDDGYY
FT                   AAFQEIERDAREKLAGGRRHIYEAEMKERRRTHGMPGHEATPEA"
     MANDHGRAVD QDHSRPANVD DTTVEALGEL SKALETVHRV RGHLYSAHQL VGGADLTLDR        60
     VVKLLREAGH DETADRVEHE LLGRNLLPGR WTFQIMEEFD DGYYAAFQEI ERDAREKLAG       120
     GRRHIYEAEM KERRRTHGMP GHEATPEA                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page