(data stored in SCRATCH zone)

EMBL: CP002399.PE663

CP002399.PE663       Location/Qualifiers
FT   CDS             679039..679554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0669"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmi:CMM_2067 D-alanyl-D-alanine
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06217"
FT                   /inference="similar to AA sequence:KEGG:CMM_2067"
FT                   /protein_id="ADU06217.1"
FT                   /translation="MSARIGEALRELEQDMTGLRLSPAAQVRARGRARSRRRAAVLAGV
FT                   AAVTVTGGAATMATLSGPATPMPAGGGAATPSAAASAACQADPPVRLDVVFRPGAGTPQ
FT                   IGEVDYRIGQARGDTGLRCGGRTVAARPDGDGRVVLSVLLAQGEDPAPIRAAVEKLPGV
FT                   ERVVTAGG"
     MSARIGEALR ELEQDMTGLR LSPAAQVRAR GRARSRRRAA VLAGVAAVTV TGGAATMATL        60
     SGPATPMPAG GGAATPSAAA SAACQADPPV RLDVVFRPGA GTPQIGEVDY RIGQARGDTG       120
     LRCGGRTVAA RPDGDGRVVL SVLLAQGEDP APIRAAVEKL PGVERVVTAG G                171
//

If you have problems or comments...

PBIL Back to PBIL home page