(data stored in SCRATCH zone)

EMBL: CP002399.PE668

CP002399.PE668       Location/Qualifiers
FT   CDS             complement(684949..686874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0674"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /note="KEGG: saq:Sare_0471 proton-translocating
FT                   NADH-quinone oxidoreductase, chain L; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06222"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ADU06222.1"
FT                   /translation="MSTPTLWLAAVLPAAPLVASLLGLLLPPAPRQDRAAARRSAVALG
FT                   VAGAAVSLLAALALLVRVDAPVEASTTWVDLGGLRVTLGLRLDGVAVLVATAVAAVALA
FT                   VQVYSIGYLRRGPHDDVDVDHRYPPYAAQLSLFTAAMLTVVVSGDLIMLLVGWEVMGVC
FT                   SYLLIAHDRRLPEAPGAAVKAFLVTRVGDVGFLLGIALLGVGAGSFRIADVLAHDYGTG
FT                   TLTAACLLLLAGVAGKSAQFPLHTWLPDAMAGPTPVSALIHAATMVAAGVYAVARLFPL
FT                   FERAPAALAVLGVMAAITMLLGAFAATAQDDIKRVLAWSTVSQIGYMTGALAVGAPAAA
FT                   LFHLLTHAAFKALLFLAAGAVIHAVGTTLMSRMGGLRTAMPVTFWCMVVGLGALAGVPP
FT                   LSGFWSKDGVLAAAEAAALDGAGPTAAWVGWLVWLAGLVGVAVTAWYATRLLLRTFLGR
FT                   TRTPLLRPHDPPALLRWPVLLLTVPAALLGLAAFAPWFADRLRVPGDDTAEAVELVHLA
FT                   PNLILPFLLLLAGAGVAWAGWRRDLAADPARFLGPLRPVFARAFRLDDVQHALVVRPAG
FT                   ALARVVRTGDELGVDGLVEGSGRAAVEVGGGLAALHRAALPRAAAGVLAGALLIGLAVA
FT                   LIGVTS"
     MSTPTLWLAA VLPAAPLVAS LLGLLLPPAP RQDRAAARRS AVALGVAGAA VSLLAALALL        60
     VRVDAPVEAS TTWVDLGGLR VTLGLRLDGV AVLVATAVAA VALAVQVYSI GYLRRGPHDD       120
     VDVDHRYPPY AAQLSLFTAA MLTVVVSGDL IMLLVGWEVM GVCSYLLIAH DRRLPEAPGA       180
     AVKAFLVTRV GDVGFLLGIA LLGVGAGSFR IADVLAHDYG TGTLTAACLL LLAGVAGKSA       240
     QFPLHTWLPD AMAGPTPVSA LIHAATMVAA GVYAVARLFP LFERAPAALA VLGVMAAITM       300
     LLGAFAATAQ DDIKRVLAWS TVSQIGYMTG ALAVGAPAAA LFHLLTHAAF KALLFLAAGA       360
     VIHAVGTTLM SRMGGLRTAM PVTFWCMVVG LGALAGVPPL SGFWSKDGVL AAAEAAALDG       420
     AGPTAAWVGW LVWLAGLVGV AVTAWYATRL LLRTFLGRTR TPLLRPHDPP ALLRWPVLLL       480
     TVPAALLGLA AFAPWFADRL RVPGDDTAEA VELVHLAPNL ILPFLLLLAG AGVAWAGWRR       540
     DLAADPARFL GPLRPVFARA FRLDDVQHAL VVRPAGALAR VVRTGDELGV DGLVEGSGRA       600
     AVEVGGGLAA LHRAALPRAA AGVLAGALLI GLAVALIGVT S                           641
//

If you have problems or comments...

PBIL Back to PBIL home page