(data stored in SCRATCH zone)

EMBL: CP002399.PE684

CP002399.PE684       Location/Qualifiers
FT   CDS             703416..703787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0690"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: saq:Sare_4338 cold-shock DNA-binding
FT                   domain-containing protein; PFAM: Cold-shock protein
FT                   DNA-binding; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06238"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADU06238.1"
FT                   /translation="MKWYDAAKGYGFVTSDEGGDVFLPKGALPAGVADLKGGQRVDFSV
FT                   VDSRRGAQAMGVKLLEAPPSVAELRRRPAEELHGLVEDMIKVLEAKVQPDLRRGRFPDR
FT                   KTSQKIAQLVHAVARELEV"
     MKWYDAAKGY GFVTSDEGGD VFLPKGALPA GVADLKGGQR VDFSVVDSRR GAQAMGVKLL        60
     EAPPSVAELR RRPAEELHGL VEDMIKVLEA KVQPDLRRGR FPDRKTSQKI AQLVHAVARE       120
     LEV                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page