(data stored in SCRATCH zone)

EMBL: CP002399.PE688

CP002399.PE688       Location/Qualifiers
FT   CDS             complement(706480..707193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0694"
FT                   /product="futalosine nucleosidase"
FT                   /note="KEGG: stp:Strop_0412 hypothetical protein; TIGRFAM:
FT                   futalosine nucleosidase; PFAM: purine or other
FT                   phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06242"
FT                   /inference="protein motif:TFAM:TIGR03664"
FT                   /protein_id="ADU06242.1"
FT                   /translation="MTGLLVVTAVPAEAEAIRAGLTAPAAPNGTAAPDGTAPPDATAPP
FT                   DVTVLPVGVGPAVAGAATARLLALAEAAGRPYRAVVSAGIAGGFVGRVAVGGTVLADRS
FT                   VAADLGAESPAGFIPVEDLGMPPELLGGGRIVLADPGLLARLRAALPGATVGTVLTVST
FT                   VTGTAASTAALAERHPDAVAEAMEGYGVAVAAAQAGVPFAELRTVSNPIGPRDRSAWRM
FT                   REAFAALTAAAAALQ"
     MTGLLVVTAV PAEAEAIRAG LTAPAAPNGT AAPDGTAPPD ATAPPDVTVL PVGVGPAVAG        60
     AATARLLALA EAAGRPYRAV VSAGIAGGFV GRVAVGGTVL ADRSVAADLG AESPAGFIPV       120
     EDLGMPPELL GGGRIVLADP GLLARLRAAL PGATVGTVLT VSTVTGTAAS TAALAERHPD       180
     AVAEAMEGYG VAVAAAQAGV PFAELRTVSN PIGPRDRSAW RMREAFAALT AAAAALQ          237
//

If you have problems or comments...

PBIL Back to PBIL home page