(data stored in SCRATCH zone)

EMBL: CP002399.PE689

CP002399.PE689       Location/Qualifiers
FT   CDS             complement(707190..708806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0695"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0413 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06243"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU06243.1"
FT                   /translation="MALSSRSGRSFLGRTVGTGIRATRLLLRGSLHGGRWMTRRAGTAR
FT                   ARSAGNEVGMVRLFDLHALSCAGDTLIAIGLAGTIFFDVPLGEARNKVALYLLVTMVPF
FT                   AMLAPVVGPLLDHFRHGRRYALATTMLGRAFLAWLISDYIGGFGLYPAAFGVLALSRAY
FT                   GVARSAAVPRLLPEGLGLSQVGARASVYGTVAGALVAPIGLAAFWFGPQWPLRVASVIF
FT                   LIGMVISLRLPPKADSEPPERMPHPLRALRRRDGERPLGRGRPSGRLVIATLIGAAALR
FT                   GLYGFLLLFLAFAIKAGDLTTDFFGRDLGAQGALGLVGGALAVGTFLATALGTRLRIHR
FT                   PTALQSSGTIVVAGVAVLAALKFSLPMVALLCLVAAMMSGIAKLAVDASIQERIPERLR
FT                   ASSFAHSETALMLAFVAGGGLGLVPFTGLIGVTVAAAVAALVAVRGVLVAGKLRGEHLA
FT                   GRPLGDEELAAEQATRAEKPATTSFDDPAPTSPAPQRSGPPPDDDGLAPPGFHIYRPSS
FT                   SVGGPGGVEDTERRDPRGPVA"
     MALSSRSGRS FLGRTVGTGI RATRLLLRGS LHGGRWMTRR AGTARARSAG NEVGMVRLFD        60
     LHALSCAGDT LIAIGLAGTI FFDVPLGEAR NKVALYLLVT MVPFAMLAPV VGPLLDHFRH       120
     GRRYALATTM LGRAFLAWLI SDYIGGFGLY PAAFGVLALS RAYGVARSAA VPRLLPEGLG       180
     LSQVGARASV YGTVAGALVA PIGLAAFWFG PQWPLRVASV IFLIGMVISL RLPPKADSEP       240
     PERMPHPLRA LRRRDGERPL GRGRPSGRLV IATLIGAAAL RGLYGFLLLF LAFAIKAGDL       300
     TTDFFGRDLG AQGALGLVGG ALAVGTFLAT ALGTRLRIHR PTALQSSGTI VVAGVAVLAA       360
     LKFSLPMVAL LCLVAAMMSG IAKLAVDASI QERIPERLRA SSFAHSETAL MLAFVAGGGL       420
     GLVPFTGLIG VTVAAAVAAL VAVRGVLVAG KLRGEHLAGR PLGDEELAAE QATRAEKPAT       480
     TSFDDPAPTS PAPQRSGPPP DDDGLAPPGF HIYRPSSSVG GPGGVEDTER RDPRGPVA         538
//

If you have problems or comments...

PBIL Back to PBIL home page