(data stored in SCRATCH zone)

EMBL: CP002399.PE694

CP002399.PE694       Location/Qualifiers
FT   CDS             712155..713441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0700"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   saq:Sare_0506 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06248"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU06248.1"
FT                   /translation="MQAKLSTMFQSLRVRNYRLFATGQLIKLIGVWMMFIAQDWLVLEL
FT                   SDNSATALGVVTALQFTPVLLLTLLSGRLADRYDKRMLLFVANAFWTVLSLAMSILVLT
FT                   GLVQLWHVFTFAALLGVANAVETPVRQAFVSELVGMPLLPNALSLNAAVFNSARIVGPA
FT                   VAGLAIAVVDVGPVFLVTALSSIAPLVNVVRMRTDELHRKDLPPVGERDQARVVDGLRY
FT                   VARRPDILLPMVLMSVIGMSLFNFQLTLAALAKTVFNTGAASFGLFSTALAAGALVGAL
FT                   AGTGRRSRPSVWLVLGAAIGCAIFGTLVGLAPAYWMVVTLLLPAGFFMIYFAQAANQRV
FT                   QLGVDASFRGRVMALWVLVFLGTNPVGAPLIGWVAETYGAGASIWAGGLISLTAALLAL
FT                   TWQLRRSGARLRMRVLPMPRFYVVSPGAK"
     MQAKLSTMFQ SLRVRNYRLF ATGQLIKLIG VWMMFIAQDW LVLELSDNSA TALGVVTALQ        60
     FTPVLLLTLL SGRLADRYDK RMLLFVANAF WTVLSLAMSI LVLTGLVQLW HVFTFAALLG       120
     VANAVETPVR QAFVSELVGM PLLPNALSLN AAVFNSARIV GPAVAGLAIA VVDVGPVFLV       180
     TALSSIAPLV NVVRMRTDEL HRKDLPPVGE RDQARVVDGL RYVARRPDIL LPMVLMSVIG       240
     MSLFNFQLTL AALAKTVFNT GAASFGLFST ALAAGALVGA LAGTGRRSRP SVWLVLGAAI       300
     GCAIFGTLVG LAPAYWMVVT LLLPAGFFMI YFAQAANQRV QLGVDASFRG RVMALWVLVF       360
     LGTNPVGAPL IGWVAETYGA GASIWAGGLI SLTAALLALT WQLRRSGARL RMRVLPMPRF       420
     YVVSPGAK                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page