(data stored in SCRATCH zone)

EMBL: CP002399.PE695

CP002399.PE695       Location/Qualifiers
FT   CDS             713517..714026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0701"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06249"
FT                   /inference="similar to AA sequence:KEGG:Strop_0419"
FT                   /protein_id="ADU06249.1"
FT                   /translation="MEVGQGLLLALAILAVCCLPALFALLFCADEIIDRVACGWAEWRE
FT                   QRRERRTIARLDRAIEAEALTRDIDLTEFDKDGRRPLEQLATDLRRLGGHRLAAADRSV
FT                   VWHGAVIEAYDERLRAACHALGIAEHLAELDGVDREIERVRVEGLLHAAGLTLPAARAA
FT                   HHQRHR"
     MEVGQGLLLA LAILAVCCLP ALFALLFCAD EIIDRVACGW AEWREQRRER RTIARLDRAI        60
     EAEALTRDID LTEFDKDGRR PLEQLATDLR RLGGHRLAAA DRSVVWHGAV IEAYDERLRA       120
     ACHALGIAEH LAELDGVDRE IERVRVEGLL HAAGLTLPAA RAAHHQRHR                   169
//

If you have problems or comments...

PBIL Back to PBIL home page