(data stored in SCRATCH zone)

EMBL: CP002399.PE697

CP002399.PE697       Location/Qualifiers
FT   CDS             complement(714663..715649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0703"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sna:Snas_1656
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06251"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU06251.1"
FT                   /translation="MEYTNLGRTGLSVSRLCLGTMNFGPQTDEPDSFAIMDRALEHGIN
FT                   FFDTANVYGWKLGEGVTEQIVGRWFAQGGGRRDKVVLATKVYGKMGEWPNEQGLSARHI
FT                   IRACEDSLRRLQTDTIDLYQMHHISRTTPWEEIWQAMETLVAQGKVLYVGSSNFAGWHI
FT                   AQAQAAAGKRNFLGLVSEQCIYNLLTRYVELEVVPAAQHYGLGIIPWSPLHGGLLSGII
FT                   RKMAEGSAARGTTGRSADALAEHRNTIEAYEKLCADLGHDPADVALAWLLSRPGVTAPI
FT                   VGPRTMDQLDRNLGALDVQLDESTLTRLDELFPPVGNGGPGPEAWAW"
     MEYTNLGRTG LSVSRLCLGT MNFGPQTDEP DSFAIMDRAL EHGINFFDTA NVYGWKLGEG        60
     VTEQIVGRWF AQGGGRRDKV VLATKVYGKM GEWPNEQGLS ARHIIRACED SLRRLQTDTI       120
     DLYQMHHISR TTPWEEIWQA METLVAQGKV LYVGSSNFAG WHIAQAQAAA GKRNFLGLVS       180
     EQCIYNLLTR YVELEVVPAA QHYGLGIIPW SPLHGGLLSG IIRKMAEGSA ARGTTGRSAD       240
     ALAEHRNTIE AYEKLCADLG HDPADVALAW LLSRPGVTAP IVGPRTMDQL DRNLGALDVQ       300
     LDESTLTRLD ELFPPVGNGG PGPEAWAW                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page