(data stored in SCRATCH zone)

EMBL: CP002399.PE702

CP002399.PE702       Location/Qualifiers
FT   CDS             720409..721701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0708"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0425 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06256"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU06256.1"
FT                   /translation="MTDVTQARRRGARRWAIDLRPLRVPAYRRVWTGNAIAMFGFQFTA
FT                   VAVPVEMFDLTGGSLWVGLLGIAGFVPLLIFGLWGGAVADARDRRRVLLVGGCVLWVST
FT                   LGLLVQSLAGARSPLLLLLLVGLQSTAFAITSPARSAILPRLVPAELVPAATTLNFTTF
FT                   TAAAVFGPLAAGLIFAAWQVGVALPIAYAADALLFTASLWATLRLPAMPPAPDPDGGVR
FT                   KAGFASIVDGFRYLATTRVLLLSFAIDLIAMILAMPRALFPELAQERFGGASAVGWLYS
FT                   SIAIGAMLGGLTSGWIGRVRRQGLALTVAVVGWGVAIALAGLAGQLWVAVVLLGVAGAA
FT                   DLVSATLRQSMLLVYAPDRMRGRLQGVNTVVVAGGPRLGDLRAGAMAAGFGTGFAMVGG
FT                   GLAAAVLAVLLVVAFPALLRYRSTTPAEDRH"
     MTDVTQARRR GARRWAIDLR PLRVPAYRRV WTGNAIAMFG FQFTAVAVPV EMFDLTGGSL        60
     WVGLLGIAGF VPLLIFGLWG GAVADARDRR RVLLVGGCVL WVSTLGLLVQ SLAGARSPLL       120
     LLLLVGLQST AFAITSPARS AILPRLVPAE LVPAATTLNF TTFTAAAVFG PLAAGLIFAA       180
     WQVGVALPIA YAADALLFTA SLWATLRLPA MPPAPDPDGG VRKAGFASIV DGFRYLATTR       240
     VLLLSFAIDL IAMILAMPRA LFPELAQERF GGASAVGWLY SSIAIGAMLG GLTSGWIGRV       300
     RRQGLALTVA VVGWGVAIAL AGLAGQLWVA VVLLGVAGAA DLVSATLRQS MLLVYAPDRM       360
     RGRLQGVNTV VVAGGPRLGD LRAGAMAAGF GTGFAMVGGG LAAAVLAVLL VVAFPALLRY       420
     RSTTPAEDRH                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page