(data stored in SCRATCH zone)

EMBL: CP002399.PE707

CP002399.PE707       Location/Qualifiers
FT   CDS             724934..725710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0713"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_6854 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06261"
FT                   /inference="similar to AA sequence:KEGG:SGR_6854"
FT                   /protein_id="ADU06261.1"
FT                   /translation="MARDGDINEPTREFPDYPTSESLRDRAEGSPDHDREYAPGAPASG
FT                   GGPARGLLWVLGAAALAVVVLLGVQATGLLPDFRNPFAKEQTDRSQPPLLKSIRDLSRY
FT                   VAAEGNFQVVVDVQNDRRNVPDFLLNERTLFVGAGRVEAYVDFGKIADGAVVVSEDGKS
FT                   AEIKLPAPQLGETDLDMDKSYVFAEQRGLINRLNDLVAGDPNRQQQVYKLAEDRITAAA
FT                   RDSGLTARAQENTRKMLEGLLRSLGYEKVTVTYTAP"
     MARDGDINEP TREFPDYPTS ESLRDRAEGS PDHDREYAPG APASGGGPAR GLLWVLGAAA        60
     LAVVVLLGVQ ATGLLPDFRN PFAKEQTDRS QPPLLKSIRD LSRYVAAEGN FQVVVDVQND       120
     RRNVPDFLLN ERTLFVGAGR VEAYVDFGKI ADGAVVVSED GKSAEIKLPA PQLGETDLDM       180
     DKSYVFAEQR GLINRLNDLV AGDPNRQQQV YKLAEDRITA AARDSGLTAR AQENTRKMLE       240
     GLLRSLGYEK VTVTYTAP                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page