(data stored in SCRATCH zone)

EMBL: CP002399.PE714

CP002399.PE714       Location/Qualifiers
FT   CDS             734098..735411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0720"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: stp:Strop_0435 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06268"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU06268.1"
FT                   /translation="MATVALKDVTKVFPDGTVAVDTINLDVNDGEFMVLLGPSGCGKST
FT                   VLRMVAGLEDPSSGAIMLGGELANDLPPRDRKIAMVFQDFALYPHMTVGDNIGFPLRLS
FT                   GVEPGPRGERIQDVASALGIGDVLGRKPSQLSGGQRQRVAMGRAIVRRPGLFLMDEPLS
FT                   NLDSGLRAELRAEISGLTRELGVTTIYVTHDQAEALTMADRVAIMRKGVLQDVGTPTQV
FT                   YGRPATLYVAAFLGSPRMNLLEASVYVHLDRYVALNLGEQSLYLPWDDIRSRAVAHYHG
FT                   ERIVVGMRAEALTPVAPDTAGDVLHGRIRYLEHHGHESLAFLDIGATAIVVDEMGTPVE
FT                   QAAPGQRGLRRFNQVMQRLTGRATESSAPAPEAGGGGGNRTSVLPDPGRHHRRPAELAV
FT                   RLAPYPQVSPGHPLAVQVRMDALHFFDERGDRIDVGWR"
     MATVALKDVT KVFPDGTVAV DTINLDVNDG EFMVLLGPSG CGKSTVLRMV AGLEDPSSGA        60
     IMLGGELAND LPPRDRKIAM VFQDFALYPH MTVGDNIGFP LRLSGVEPGP RGERIQDVAS       120
     ALGIGDVLGR KPSQLSGGQR QRVAMGRAIV RRPGLFLMDE PLSNLDSGLR AELRAEISGL       180
     TRELGVTTIY VTHDQAEALT MADRVAIMRK GVLQDVGTPT QVYGRPATLY VAAFLGSPRM       240
     NLLEASVYVH LDRYVALNLG EQSLYLPWDD IRSRAVAHYH GERIVVGMRA EALTPVAPDT       300
     AGDVLHGRIR YLEHHGHESL AFLDIGATAI VVDEMGTPVE QAAPGQRGLR RFNQVMQRLT       360
     GRATESSAPA PEAGGGGGNR TSVLPDPGRH HRRPAELAVR LAPYPQVSPG HPLAVQVRMD       420
     ALHFFDERGD RIDVGWR                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page