(data stored in SCRATCH zone)

EMBL: CP002399.PE8

CP002399.PE8         Location/Qualifiers
FT   CDS             complement(7776..8330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05562"
FT                   /inference="similar to AA sequence:KEGG:Strop_0007"
FT                   /protein_id="ADU05562.1"
FT                   /translation="MGLDNVAVHWPRTGRFYDPVAPAEFVDFGEIVDMPRISAPTAALA
FT                   ELIAKTGTVRATAYTELVDLILGLENVLYATENAVEDEDPVIDPDGCSWIAEGVEKFVA
FT                   RHRPYGEPVTFESVSEVLRALLGDGRLAEQQLRWLDSRLDRLRDESGDPPQWNFTCAEL
FT                   SVLAAFYRRCAERGFAVYADA"
     MGLDNVAVHW PRTGRFYDPV APAEFVDFGE IVDMPRISAP TAALAELIAK TGTVRATAYT        60
     ELVDLILGLE NVLYATENAV EDEDPVIDPD GCSWIAEGVE KFVARHRPYG EPVTFESVSE       120
     VLRALLGDGR LAEQQLRWLD SRLDRLRDES GDPPQWNFTC AELSVLAAFY RRCAERGFAV       180
     YADA                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page