(data stored in SCRATCH zone)

EMBL: CP002399.PE84

CP002399.PE84        Location/Qualifiers
FT   CDS             complement(87126..87776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0084"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: saq:Sare_0054 para-aminobenzoate synthase
FT                   component II; TIGRFAM: glutamine amidotransferase of
FT                   anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05638"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADU05638.1"
FT                   /translation="MRVLVIDNYDSFVFNLVQYLGQLGADCEVRRNDEIDVAEVGRAGA
FT                   AGVLLSPGPGSPDRAGICLDVIREYAGKLPIFGVCLGHQAIGEAFGATVARAPELLHGK
FT                   TSEVRHDGVGVLAGLPDPFTATRYHSLAVLPETLPDELEVTGRTASGVVMAMRHRTLPI
FT                   EGVQFHPESVLTEGGHLMLANWLAACGFPAALERAPELAAEVDARRQAAFSPA"
     MRVLVIDNYD SFVFNLVQYL GQLGADCEVR RNDEIDVAEV GRAGAAGVLL SPGPGSPDRA        60
     GICLDVIREY AGKLPIFGVC LGHQAIGEAF GATVARAPEL LHGKTSEVRH DGVGVLAGLP       120
     DPFTATRYHS LAVLPETLPD ELEVTGRTAS GVVMAMRHRT LPIEGVQFHP ESVLTEGGHL       180
     MLANWLAACG FPAALERAPE LAAEVDARRQ AAFSPA                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page