(data stored in SCRATCH zone)

EMBL: CP002399.PE99

CP002399.PE99        Location/Qualifiers
FT   CDS             104363..104782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gob:Gobs_4773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05653"
FT                   /inference="similar to AA sequence:KEGG:Gobs_4773"
FT                   /protein_id="ADU05653.1"
FT                   /translation="MKSMNDVFNEAVDYGAEGVVPVGTPVGVEKLSHVHRVFNAVMGGG
FT                   LGFAVEVLEPDDFRRAVEGFRYLDLGEVANLLAELVDSYGSSDYDVRKEEILDGLLVGA
FT                   LVDDAFRRKVSQAPSDFGFDGSVLQDPAAQQRQLR"
     MKSMNDVFNE AVDYGAEGVV PVGTPVGVEK LSHVHRVFNA VMGGGLGFAV EVLEPDDFRR        60
     AVEGFRYLDL GEVANLLAEL VDSYGSSDYD VRKEEILDGL LVGALVDDAF RRKVSQAPSD       120
     FGFDGSVLQD PAAQQRQLR                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page