(data stored in ACNUC9435 zone)

EMBL: CP002400.PE1

CP002400.PE1         Location/Qualifiers
FT   CDS             331..1674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   cbl:CLK_3133 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25592"
FT                   /db_xref="GOA:E6U5C5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5C5"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADU25592.1"
FT                   /translation="MQSFKEVWEGVCLFCKEKISDVAFKTWIYCMEPVELHSNEAVFFV
FT                   RSDFQRNIIYDRYKQLLKDGFEHILGFPVDIRIVTEDDKPNGYRSQYDFVVTQNPEDIE
FT                   QTYASADYEYTFDTFIVGSSNKFAHAASMAVASTPAMAYNPLFIYGGSGLGKTHLLHAI
FT                   RHEILKNNPNSKILYIKGEDFTNELVESIRQNSQIQFRNKYRQTDVLLVDDIQFVAGKE
FT                   STQEEFFHTFNSLYESKKQIVLTSDRPPKEIQTLEDRLRTRFEWGLLADIQPPDFETRL
FT                   AIIRRKAELLGINIPDEVDEYIANRLKNNIRQLEGAVKKIKAYNLLTGDPPSIAIAQNA
FT                   IRDILNDNQPVPVTIDRIIGEVSRTFGVSADDIKGKMRSGNVSTARQVSMYIIREITQM
FT                   STSAIGEKFNGRDHSTVVYAIQKVEDDMKNKPHLKATVEDIIKNIRAN"
     MQSFKEVWEG VCLFCKEKIS DVAFKTWIYC MEPVELHSNE AVFFVRSDFQ RNIIYDRYKQ        60
     LLKDGFEHIL GFPVDIRIVT EDDKPNGYRS QYDFVVTQNP EDIEQTYASA DYEYTFDTFI       120
     VGSSNKFAHA ASMAVASTPA MAYNPLFIYG GSGLGKTHLL HAIRHEILKN NPNSKILYIK       180
     GEDFTNELVE SIRQNSQIQF RNKYRQTDVL LVDDIQFVAG KESTQEEFFH TFNSLYESKK       240
     QIVLTSDRPP KEIQTLEDRL RTRFEWGLLA DIQPPDFETR LAIIRRKAEL LGINIPDEVD       300
     EYIANRLKNN IRQLEGAVKK IKAYNLLTGD PPSIAIAQNA IRDILNDNQP VPVTIDRIIG       360
     EVSRTFGVSA DDIKGKMRSG NVSTARQVSM YIIREITQMS TSAIGEKFNG RDHSTVVYAI       420
     QKVEDDMKNK PHLKATVEDI IKNIRAN                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page