(data stored in ACNUC9435 zone)

EMBL: CP002400.PE112

CP002400.PE112       Location/Qualifiers
FT   CDS             complement(115374..116183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cce:Ccel_2649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25703"
FT                   /db_xref="UniProtKB/TrEMBL:E6U624"
FT                   /inference="similar to AA sequence:KEGG:Ccel_2649"
FT                   /protein_id="ADU25703.1"
FT                   /translation="MEHIKKNGLRILIISIACGTLDFVLQGATASLHVNNLNTIEPSMF
FT                   VRIGLIYPLLIAYYWADYLIMAIIFVWIEQGLPGNRWLEGLTYGLCIGGLYLIGMYEGI
FT                   LILNDTVINATWVGLCDGLPIVFMGVLAGIFTGTPGVQGRYRRRLYQVPIISMLYVGGR
FT                   YFSYGVLHIHSAYVAMPLGTFVWTLCQGAWIGVLYVLLRPGIKRVAPITKALFFGTVIF
FT                   GLNWLMYHFFIPMMFETSIADILIRVGVDSLSVTIGAYICERRAHTA"
     MEHIKKNGLR ILIISIACGT LDFVLQGATA SLHVNNLNTI EPSMFVRIGL IYPLLIAYYW        60
     ADYLIMAIIF VWIEQGLPGN RWLEGLTYGL CIGGLYLIGM YEGILILNDT VINATWVGLC       120
     DGLPIVFMGV LAGIFTGTPG VQGRYRRRLY QVPIISMLYV GGRYFSYGVL HIHSAYVAMP       180
     LGTFVWTLCQ GAWIGVLYVL LRPGIKRVAP ITKALFFGTV IFGLNWLMYH FFIPMMFETS       240
     IADILIRVGV DSLSVTIGAY ICERRAHTA                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page