(data stored in ACNUC9435 zone)

EMBL: CP002400.PE119

CP002400.PE119       Location/Qualifiers
FT   CDS             complement(126848..127225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: adg:Adeg_1127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25710"
FT                   /db_xref="UniProtKB/TrEMBL:E6U631"
FT                   /inference="similar to AA sequence:KEGG:Adeg_1127"
FT                   /protein_id="ADU25710.1"
FT                   /translation="MDISFPNYADSFKCDGSKMDMPPKGRFFERMVFLKTNPYAYTYTP
FT                   VIGIWDARILTVFVYNTGEAPIKVHIQNTPDGRHFVNDTQILSLDPDEIGSLVPCIFSK
FT                   GLRIAGIGGPGTAQIWAQMQM"
     MDISFPNYAD SFKCDGSKMD MPPKGRFFER MVFLKTNPYA YTYTPVIGIW DARILTVFVY        60
     NTGEAPIKVH IQNTPDGRHF VNDTQILSLD PDEIGSLVPC IFSKGLRIAG IGGPGTAQIW       120
     AQMQM                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page