(data stored in ACNUC9435 zone)

EMBL: CP002400.PE126

CP002400.PE126       Location/Qualifiers
FT   CDS             complement(136721..138259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0130"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="KEGG: ele:Elen_2494 ATPase associated with various
FT                   cellular activities AAA_5; PFAM: ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25717"
FT                   /db_xref="GOA:E6U638"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U638"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADU25717.1"
FT                   /translation="MNIKEAKQQIQNAVRAYLTKDAFGDYCISAEKQRPILLIGAPGIG
FT                   KTAVMEQVAREMGINLVAYSMTHHTRQSAVGLPFIEHRTYDGTEYTVSEYTMSEIIASV
FT                   YETAEKSGIREGLLFLDEINCVSETLAPAMLQFLQYKVFGRHRIPDGWVVVAAGNPPEY
FT                   NNSVREFDVATLDRLKKVIVEPDYTVWKEYAYQSGVHGAVLSYLDIKKDHFYAVQSTVE
FT                   GKSFVTARGWEDLSQMMTLYERLGIPVDEALTAQYIQHPDIARDFAVYYELYKKYKQEY
FT                   GVETILKGKAEEALARTAGEARFDEKLSLIGMLVDAVSGDIRRCLRTEDVVTAVYGVLK
FT                   TVKPALTETPERYAEVFEQCIAEQRQAVETARRANTLLREKKQVAGAVVDALEDLRDAV
FT                   ARAGCGTDCFGVVRAGFEERARGLKTQSETVRGRLDALFAFAEQAYGEGQEMLILVTNL
FT                   TLSPDAARFIATYGCERYYAHNKEALLFERQNDILLKMQKLREEFHTPENEETL"
     MNIKEAKQQI QNAVRAYLTK DAFGDYCISA EKQRPILLIG APGIGKTAVM EQVAREMGIN        60
     LVAYSMTHHT RQSAVGLPFI EHRTYDGTEY TVSEYTMSEI IASVYETAEK SGIREGLLFL       120
     DEINCVSETL APAMLQFLQY KVFGRHRIPD GWVVVAAGNP PEYNNSVREF DVATLDRLKK       180
     VIVEPDYTVW KEYAYQSGVH GAVLSYLDIK KDHFYAVQST VEGKSFVTAR GWEDLSQMMT       240
     LYERLGIPVD EALTAQYIQH PDIARDFAVY YELYKKYKQE YGVETILKGK AEEALARTAG       300
     EARFDEKLSL IGMLVDAVSG DIRRCLRTED VVTAVYGVLK TVKPALTETP ERYAEVFEQC       360
     IAEQRQAVET ARRANTLLRE KKQVAGAVVD ALEDLRDAVA RAGCGTDCFG VVRAGFEERA       420
     RGLKTQSETV RGRLDALFAF AEQAYGEGQE MLILVTNLTL SPDAARFIAT YGCERYYAHN       480
     KEALLFERQN DILLKMQKLR EEFHTPENEE TL                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page