(data stored in ACNUC9435 zone)

EMBL: CP002400.PE127

CP002400.PE127       Location/Qualifiers
FT   CDS             complement(138256..140010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_2493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25718"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="UniProtKB/TrEMBL:E6U639"
FT                   /inference="similar to AA sequence:KEGG:Elen_2493"
FT                   /protein_id="ADU25718.1"
FT                   /translation="MKDEKDASFLDRADPLAREILGLTRSAMFVKLRFLDAALGHLPFA
FT                   RQDDIGRIATDGKHLFYNPRFILQRYEESADRLARDCLHLVFHCVLRHPFFLGQVRPAW
FT                   WNLAVDIAVENTLNELDVFPTGRVHETAAEQVLTELRGPVRSLSAEGLYRYFAREGLDD
FT                   DSASRLRQLFYHDDHIGWYARDEREEHTRTGDQNVVEQGQASEQDAGSGGESDAKSENR
FT                   REKEGAGGGEPGQDKPQPGDGNNADTPSDKTETPSGQAPPSPGGGDPSGDANQSQTENT
FT                   PGQESGGTGEGNDGQAGGKDGGEEESPMKLPAPREDGLFALWKQISRRMQTDLETTSRR
FT                   WGEESGSLLQSIRGANRDKCDYSAFLRRFSTRGEQMKVNDDEFDYIFYTHGLERYGNMP
FT                   LIEPLEYKEVRKVREFVIAIDTSASCSGELVQGFVRKTYSILKQQECFFRRLNIHIIQC
FT                   DAEIQSDVLITCEADLERYIAEQKLHGFGGTDFRPVFAYIDDLLAKHAFFDLRGLVYFS
FT                   DGYGVFPLKKPPYDTAFVFLGDDEERKVPSWVIPVRMTEEELYDLVEQPETDAQQNARG
FT                   GDEKEAAI"
     MKDEKDASFL DRADPLAREI LGLTRSAMFV KLRFLDAALG HLPFARQDDI GRIATDGKHL        60
     FYNPRFILQR YEESADRLAR DCLHLVFHCV LRHPFFLGQV RPAWWNLAVD IAVENTLNEL       120
     DVFPTGRVHE TAAEQVLTEL RGPVRSLSAE GLYRYFAREG LDDDSASRLR QLFYHDDHIG       180
     WYARDEREEH TRTGDQNVVE QGQASEQDAG SGGESDAKSE NRREKEGAGG GEPGQDKPQP       240
     GDGNNADTPS DKTETPSGQA PPSPGGGDPS GDANQSQTEN TPGQESGGTG EGNDGQAGGK       300
     DGGEEESPMK LPAPREDGLF ALWKQISRRM QTDLETTSRR WGEESGSLLQ SIRGANRDKC       360
     DYSAFLRRFS TRGEQMKVND DEFDYIFYTH GLERYGNMPL IEPLEYKEVR KVREFVIAID       420
     TSASCSGELV QGFVRKTYSI LKQQECFFRR LNIHIIQCDA EIQSDVLITC EADLERYIAE       480
     QKLHGFGGTD FRPVFAYIDD LLAKHAFFDL RGLVYFSDGY GVFPLKKPPY DTAFVFLGDD       540
     EERKVPSWVI PVRMTEEELY DLVEQPETDA QQNARGGDEK EAAI                        584
//

If you have problems or comments...

PBIL Back to PBIL home page