(data stored in ACNUC9435 zone)

EMBL: CP002400.PE135

CP002400.PE135       Location/Qualifiers
FT   CDS             complement(146253..147068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0139"
FT                   /product="glutamate 5-kinase"
FT                   /note="KEGG: cth:Cthe_1766 gamma-glutamyl kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25726"
FT                   /db_xref="GOA:E6U647"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:E6U647"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ADU25726.1"
FT                   /translation="MALQDAKRIVCKVGTSTLTYPNGRLHIRRIEKLVRVLSDFKNSGK
FT                   DVILVTSGAIGVGATRLGLDERPRDTRMMQAAAAVGQVELMYLYDKLFLSYGQVVAQIL
FT                   MTRILTDHDSTRQNLVNTFETLLSLGVIPVVNENDSVAVEELEEEAMAFGGNDTLSAVV
FT                   AVLVQADALVLLSDIEGLFDKNPREAPDACLIPVVESVDERVRASAGGAGSTLGTGGMV
FT                   TKLEAAEMVTKNGIDMVIMDGSDPEKLYALFDGKQVGTYFPANPKGERT"
     MALQDAKRIV CKVGTSTLTY PNGRLHIRRI EKLVRVLSDF KNSGKDVILV TSGAIGVGAT        60
     RLGLDERPRD TRMMQAAAAV GQVELMYLYD KLFLSYGQVV AQILMTRILT DHDSTRQNLV       120
     NTFETLLSLG VIPVVNENDS VAVEELEEEA MAFGGNDTLS AVVAVLVQAD ALVLLSDIEG       180
     LFDKNPREAP DACLIPVVES VDERVRASAG GAGSTLGTGG MVTKLEAAEM VTKNGIDMVI       240
     MDGSDPEKLY ALFDGKQVGT YFPANPKGER T                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page