(data stored in ACNUC9435 zone)

EMBL: CP002400.PE139

CP002400.PE139       Location/Qualifiers
FT   CDS             complement(151759..152661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0143"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; KEGG:
FT                   cbe:Cbei_4521 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25730"
FT                   /db_xref="GOA:E6U651"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E6U651"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ADU25730.1"
FT                   /translation="MKHLLKLLDLSTQEILDILNLGDQLKYELKHGIPHPRLAGKSLGM
FT                   IFEKASTRTRVSFETGMYQLGGHALFLSSKESQIGRGEPIQDTARVLSRYLSGIMIRTF
FT                   EQAEVQALADHASIPIINGLTDFAHPCQVLADLMTVREHKGRLEGLKLCFIGDGNNMAN
FT                   SLIVGGLKVGMQVAVATPENYEPDASVLDFAQKQGGFSLVRSPLEAAAGADVVITDVWA
FT                   SMGQEEEAAKRRKAFAGYQVNKELMAVAKPDAMVQHCLPAHRGEEITADVFEAHADEIF
FT                   EEAENRLHAQKAVMVQLMG"
     MKHLLKLLDL STQEILDILN LGDQLKYELK HGIPHPRLAG KSLGMIFEKA STRTRVSFET        60
     GMYQLGGHAL FLSSKESQIG RGEPIQDTAR VLSRYLSGIM IRTFEQAEVQ ALADHASIPI       120
     INGLTDFAHP CQVLADLMTV REHKGRLEGL KLCFIGDGNN MANSLIVGGL KVGMQVAVAT       180
     PENYEPDASV LDFAQKQGGF SLVRSPLEAA AGADVVITDV WASMGQEEEA AKRRKAFAGY       240
     QVNKELMAVA KPDAMVQHCL PAHRGEEITA DVFEAHADEI FEEAENRLHA QKAVMVQLMG       300
//

If you have problems or comments...

PBIL Back to PBIL home page