(data stored in ACNUC9435 zone)

EMBL: CP002400.PE142

CP002400.PE142       Location/Qualifiers
FT   CDS             complement(154481..155341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0146"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase; KEGG: cbt:CLH_2869
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25733"
FT                   /db_xref="GOA:E6U654"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:E6U654"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ADU25733.1"
FT                   /translation="MGISENETAQVLVHALPYIQQYNNKTIVVKYGGNAMVSGELKDAV
FT                   MTDLVLLSLVGIRVVLVHGGGPEITDMLKKVGKESRFVGGLRYTDRETMDIVQMVLGGK
FT                   VNKDLVLSLQHKGGRALGLCGLDGGMIEAERMFADGTDLGQVGQVTNVDVTPINDALEH
FT                   GYIPVVATMGAGRDGKVYNINADTAAARIAAALGAEKLILLTDIRGLLRDKNDENTLIP
FT                   VVNVSEVPNLIRQGIISGGMIPKIDCCVEAVRRGVNRAHIIDGRRPHSILVEMFSDGGI
FT                   GTMFL"
     MGISENETAQ VLVHALPYIQ QYNNKTIVVK YGGNAMVSGE LKDAVMTDLV LLSLVGIRVV        60
     LVHGGGPEIT DMLKKVGKES RFVGGLRYTD RETMDIVQMV LGGKVNKDLV LSLQHKGGRA       120
     LGLCGLDGGM IEAERMFADG TDLGQVGQVT NVDVTPINDA LEHGYIPVVA TMGAGRDGKV       180
     YNINADTAAA RIAAALGAEK LILLTDIRGL LRDKNDENTL IPVVNVSEVP NLIRQGIISG       240
     GMIPKIDCCV EAVRRGVNRA HIIDGRRPHS ILVEMFSDGG IGTMFL                      286
//

If you have problems or comments...

PBIL Back to PBIL home page