(data stored in ACNUC9435 zone)

EMBL: CP002400.PE144

CP002400.PE144       Location/Qualifiers
FT   CDS             complement(156769..157734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0148"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; KEGG: scl:sce4967
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25735"
FT                   /db_xref="GOA:E6U656"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6U656"
FT                   /inference="protein motif:TFAM:TIGR01851"
FT                   /protein_id="ADU25735.1"
FT                   /translation="MKHRIFVDGRHGTTGLELGARLAARDDVEQIVIDPEKHRDPAARK
FT                   ACLNEAEIVFLCLPDAAAREAVALIENPAVRVIDASTAHRTASGWIYGFPELDKAQRGK
FT                   IRTASRVAVPGCHATGFNAAVHPLRAEGVLTADYPLTAQSISGYSGAGKAMIAQYEDTR
FT                   KDDPALKSPRLYALGLHHKHLPEMQAINALEKPPLFTPMVGPYRQGMLVLLPLRRELLA
FT                   KDLDAAAVRELYAAYYQGEPFIRVIPFDDQSGFDGGYFGADGANGTNRLDLFVFGHDEE
FT                   ILVVSRLDNLGKGASGAAVQCMNLMLGIDERTALVGAAHF"
     MKHRIFVDGR HGTTGLELGA RLAARDDVEQ IVIDPEKHRD PAARKACLNE AEIVFLCLPD        60
     AAAREAVALI ENPAVRVIDA STAHRTASGW IYGFPELDKA QRGKIRTASR VAVPGCHATG       120
     FNAAVHPLRA EGVLTADYPL TAQSISGYSG AGKAMIAQYE DTRKDDPALK SPRLYALGLH       180
     HKHLPEMQAI NALEKPPLFT PMVGPYRQGM LVLLPLRREL LAKDLDAAAV RELYAAYYQG       240
     EPFIRVIPFD DQSGFDGGYF GADGANGTNR LDLFVFGHDE EILVVSRLDN LGKGASGAAV       300
     QCMNLMLGID ERTALVGAAH F                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page