(data stored in ACNUC9435 zone)

EMBL: CP002400.PE15

CP002400.PE15        Location/Qualifiers
FT   CDS             15412..16344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0015"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; KEGG:
FT                   cpy:Cphy_0882 orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25606"
FT                   /db_xref="GOA:E6U5D9"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D9"
FT                   /inference="protein motif:TFAM:TIGR02127"
FT                   /protein_id="ADU25606.1"
FT                   /translation="MDTLRKKIAARQNPTVAGLDPDFAKLPAFLREQAVARRGKTLEAA
FT                   ADAVLAFNRAIIDALCDVVPAVKPQAAYYELLGWPGVRALAETIAYAREKGLFVITDAK
FT                   RGDIGSTMAAYARAHLGTVEIEGAEITPFGADALTVNAYLGSDGVLPALEVCKAHGKCI
FT                   FVLGKTSNPSSGEIQDKLVDGEPVYSLLGHLCAHWSGMAAGGEPSGRYGTVGLVAGATY
FT                   PAQLAELRQNLPHTFFLVPGYGAQGGGARDVAPAFDENGDGAIVNSSRAILYAWRKEGC
FT                   NERDFAGAARREALRMKEDLNAVLADHSK"
     MDTLRKKIAA RQNPTVAGLD PDFAKLPAFL REQAVARRGK TLEAAADAVL AFNRAIIDAL        60
     CDVVPAVKPQ AAYYELLGWP GVRALAETIA YAREKGLFVI TDAKRGDIGS TMAAYARAHL       120
     GTVEIEGAEI TPFGADALTV NAYLGSDGVL PALEVCKAHG KCIFVLGKTS NPSSGEIQDK       180
     LVDGEPVYSL LGHLCAHWSG MAAGGEPSGR YGTVGLVAGA TYPAQLAELR QNLPHTFFLV       240
     PGYGAQGGGA RDVAPAFDEN GDGAIVNSSR AILYAWRKEG CNERDFAGAA RREALRMKED       300
     LNAVLADHSK                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page