(data stored in ACNUC9435 zone)

EMBL: CP002400.PE151

CP002400.PE151       Location/Qualifiers
FT   CDS             complement(166046..166519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0155"
FT                   /product="transcription elongation factor GreA"
FT                   /note="KEGG: cth:Cthe_2897 transcription elongation factor
FT                   GreA; TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25742"
FT                   /db_xref="GOA:E6U6K9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6K9"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ADU25742.1"
FT                   /translation="MAKQYVLTDAGLKKLEQELEQLKTEKRKEIAEKIKVALSFGDLSE
FT                   NSEYDEAKNEQAMVESRIATIEAMLKNVKLIDDDQLDTEAVNLGSKVQVFDVEFDETVE
FT                   YQIVGSTEADPDQNLISDESPVGRALLGHKVGDEVEAETPAGVLKFKVLNITK"
     MAKQYVLTDA GLKKLEQELE QLKTEKRKEI AEKIKVALSF GDLSENSEYD EAKNEQAMVE        60
     SRIATIEAML KNVKLIDDDQ LDTEAVNLGS KVQVFDVEFD ETVEYQIVGS TEADPDQNLI       120
     SDESPVGRAL LGHKVGDEVE AETPAGVLKF KVLNITK                                157
//

If you have problems or comments...

PBIL Back to PBIL home page