(data stored in ACNUC9435 zone)

EMBL: CP002400.PE165

CP002400.PE165       Location/Qualifiers
FT   CDS             complement(177866..178477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0169"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cbk:CLL_A1977
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25756"
FT                   /db_xref="GOA:E6U6M3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU25756.1"
FT                   /translation="MNKVTNRRGHAAQTQQDIFRVALELFRTTGYELTTIQDICEKANV
FT                   SVGAFYYYYKSKEDVLNDSYRQIDYTLNEKYAHVQFEDPVCGITEILCSLAGYVQEQGF
FT                   RIPAQIYKKQITATDRFMLDPNREYCILVSRLVAQACAGGRFSADYSEQTVTETILRMM
FT                   RGILYDWCLHDGSYDLVQQARADMRIILHHFEQANDLQPA"
     MNKVTNRRGH AAQTQQDIFR VALELFRTTG YELTTIQDIC EKANVSVGAF YYYYKSKEDV        60
     LNDSYRQIDY TLNEKYAHVQ FEDPVCGITE ILCSLAGYVQ EQGFRIPAQI YKKQITATDR       120
     FMLDPNREYC ILVSRLVAQA CAGGRFSADY SEQTVTETIL RMMRGILYDW CLHDGSYDLV       180
     QQARADMRII LHHFEQANDL QPA                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page