(data stored in ACNUC9435 zone)

EMBL: CP002400.PE169

CP002400.PE169       Location/Qualifiers
FT   CDS             complement(181859..182818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0173"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: eel:EUBELI_01673 hypothetical protein;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25760"
FT                   /db_xref="GOA:E6U6M7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M7"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADU25760.1"
FT                   /translation="MFIGNVEIKGHTALAPMAGVADTAFRTVCKAHGAAYVVGEMASAK
FT                   GFVMQATKTAELLGVTDAERPMAIQLFGSEPDVMAEAARRALAFSPDIIDINMGCPAPK
FT                   VAGNGGGSALLKDPALAGRIVRAVANAVPVPVTVKIRKGWDAAHVNAVEIARIAEENGA
FT                   AAVAVHGRTRAQQYAPPADWDIIAAVRRAVRIPVIGNGDVDSPQAAAHMLAQTGCDLVM
FT                   IGRAALGRPWLFGQVETYLRTGELLPEPNPARRMAVLLDHVRLLCALKGEHIGMREARK
FT                   HAAWYMKGLHGAALLRGEANKLDTFADLERLAAAAAKE"
     MFIGNVEIKG HTALAPMAGV ADTAFRTVCK AHGAAYVVGE MASAKGFVMQ ATKTAELLGV        60
     TDAERPMAIQ LFGSEPDVMA EAARRALAFS PDIIDINMGC PAPKVAGNGG GSALLKDPAL       120
     AGRIVRAVAN AVPVPVTVKI RKGWDAAHVN AVEIARIAEE NGAAAVAVHG RTRAQQYAPP       180
     ADWDIIAAVR RAVRIPVIGN GDVDSPQAAA HMLAQTGCDL VMIGRAALGR PWLFGQVETY       240
     LRTGELLPEP NPARRMAVLL DHVRLLCALK GEHIGMREAR KHAAWYMKGL HGAALLRGEA       300
     NKLDTFADLE RLAAAAAKE                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page