(data stored in ACNUC9435 zone)

EMBL: CP002400.PE171

CP002400.PE171       Location/Qualifiers
FT   CDS             complement(185055..186302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0175"
FT                   /product="ABC-type Na+ efflux pump permease component-like
FT                   protein"
FT                   /note="KEGG: cce:Ccel_1178 ABC-type Na+ efflux pump
FT                   permease component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25762"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M9"
FT                   /inference="similar to AA sequence:KEGG:Ccel_1178"
FT                   /protein_id="ADU25762.1"
FT                   /translation="MKNIGTIFRFTFREQARKKSYVIVTVLLMLVAAALVALPVLIPQW
FT                   QSGKANGKASRSVVYFDDKTTATIDPAALQQALPAYTVKTVPDGQLDALRKNILAGKEE
FT                   SGAVMAVYQETDDTNRASLSYYERSRDSGPGADELAEIIRNLRMEHLLRRAGLGPQEAD
FT                   YILQAVPATTQTGDHSDNMTGFIPAIAVCILLFIAIFTYGIWVATSIASEKTSRVLEVL
FT                   ITSTKPSAIIVGKSLAMGALGLLQLLLILGAGAVSYMAVGGASKLAVLSFASFTPGAFA
FT                   LLFVYFVLGFSLYAMLSAVAGASVSNADDLRSAMQPITILGMLSFYLAYGSFMAPGTPL
FT                   SLVASFIPFSAPFAMPARLMMAGVPWWQIVLSLLLLAGTTWGMGALSIRLYASAVLHYG
FT                   KQLKLKDLFRMAGHAK"
     MKNIGTIFRF TFREQARKKS YVIVTVLLML VAAALVALPV LIPQWQSGKA NGKASRSVVY        60
     FDDKTTATID PAALQQALPA YTVKTVPDGQ LDALRKNILA GKEESGAVMA VYQETDDTNR       120
     ASLSYYERSR DSGPGADELA EIIRNLRMEH LLRRAGLGPQ EADYILQAVP ATTQTGDHSD       180
     NMTGFIPAIA VCILLFIAIF TYGIWVATSI ASEKTSRVLE VLITSTKPSA IIVGKSLAMG       240
     ALGLLQLLLI LGAGAVSYMA VGGASKLAVL SFASFTPGAF ALLFVYFVLG FSLYAMLSAV       300
     AGASVSNADD LRSAMQPITI LGMLSFYLAY GSFMAPGTPL SLVASFIPFS APFAMPARLM       360
     MAGVPWWQIV LSLLLLAGTT WGMGALSIRL YASAVLHYGK QLKLKDLFRM AGHAK            415
//

If you have problems or comments...

PBIL Back to PBIL home page