(data stored in ACNUC9435 zone)

EMBL: CP002400.PE172

CP002400.PE172       Location/Qualifiers
FT   CDS             complement(186299..187195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0176"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cce:Ccel_1177 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25763"
FT                   /db_xref="GOA:E6U6N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADU25763.1"
FT                   /translation="MGLHVEHVRKQYGGKTAVQNLSFTMDSPGVFGLLGTNGAGKTTTI
FT                   RMLLGILEQDAGTITWDGRPVTRENVSFGYLPEERGLYPKIRVGEQLFYFASLRGMNAQ
FT                   AARQSIRRWYERLEIGKYDRMTADQLSKGNQQKVQLAAALLHDPDLVVLDEPISGLDPV
FT                   NADLFADVMREQAAEGKYIVLSSHQMESVEAFCRDILMLKDGQTVLQGNLRAIKDGYGR
FT                   TNLSVECGKDVHARAETAGLTVLEQDARGLECRIRDEADAYRFLRGLLDDGVRIDRFEI
FT                   RTPSLHEIFVEKAGARA"
     MGLHVEHVRK QYGGKTAVQN LSFTMDSPGV FGLLGTNGAG KTTTIRMLLG ILEQDAGTIT        60
     WDGRPVTREN VSFGYLPEER GLYPKIRVGE QLFYFASLRG MNAQAARQSI RRWYERLEIG       120
     KYDRMTADQL SKGNQQKVQL AAALLHDPDL VVLDEPISGL DPVNADLFAD VMREQAAEGK       180
     YIVLSSHQME SVEAFCRDIL MLKDGQTVLQ GNLRAIKDGY GRTNLSVECG KDVHARAETA       240
     GLTVLEQDAR GLECRIRDEA DAYRFLRGLL DDGVRIDRFE IRTPSLHEIF VEKAGARA         298
//

If you have problems or comments...

PBIL Back to PBIL home page