(data stored in ACNUC9435 zone)

EMBL: CP002400.PE174

CP002400.PE174       Location/Qualifiers
FT   CDS             complement(187691..187885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0178"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: slp:Slip_1330 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25765"
FT                   /db_xref="GOA:E6U6N2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU25765.1"
FT                   /translation="MENRLRELRRLRGMTQQALADAADISRQTVIAIEAGRFNPSVLLA
FT                   FRLAKALGVTIEDIFLFER"
     MENRLRELRR LRGMTQQALA DAADISRQTV IAIEAGRFNP SVLLAFRLAK ALGVTIEDIF        60
     LFER                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page