(data stored in ACNUC9435 zone)

EMBL: CP002400.PE175

CP002400.PE175       Location/Qualifiers
FT   CDS             188214..188786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ske:Sked_06170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25766"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N3"
FT                   /inference="similar to AA sequence:KEGG:Sked_06170"
FT                   /protein_id="ADU25766.1"
FT                   /translation="MEQQHDKRTWNLSRAAAITALCSLGILVCLGELRQRNIFFYFFGL
FT                   QTKLVLRITGGVLLSAVCGLIMVNLKNVVLTTIAAILYIIALMLYFICNVWTSGEEKYY
FT                   EFQSPDHKRTIVVEECSWLLAGGSNVYQKTSPFTITKLKSDISTDDGYRPFENKDFAIT
FT                   WSARTVTIAYGFGNGGDTRPFTTVQLQ"
     MEQQHDKRTW NLSRAAAITA LCSLGILVCL GELRQRNIFF YFFGLQTKLV LRITGGVLLS        60
     AVCGLIMVNL KNVVLTTIAA ILYIIALMLY FICNVWTSGE EKYYEFQSPD HKRTIVVEEC       120
     SWLLAGGSNV YQKTSPFTIT KLKSDISTDD GYRPFENKDF AITWSARTVT IAYGFGNGGD       180
     TRPFTTVQLQ                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page