(data stored in ACNUC9435 zone)

EMBL: CP002400.PE176

CP002400.PE176       Location/Qualifiers
FT   CDS             complement(188859..190121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0180"
FT                   /product="protein of unknown function DUF815"
FT                   /note="KEGG: clj:CLJU_c26700 hypothetical protein; PFAM:
FT                   protein of unknown function DUF815; AAA ATPase central
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25767"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N4"
FT                   /inference="protein motif:PFAM:PF05673"
FT                   /protein_id="ADU25767.1"
FT                   /translation="MDTVQKARLALSSLGLYRPLLEKPVVAAFAKVLETAHGAELRGFL
FT                   DAYGAFISLLAPARATAGVLDFSGALHTLVQQNDSLFARQAAAGRVEEAVRAAAARDLE
FT                   ALSMALDLSPREIKAAASASFDDDDSVAFIDSLPDFITGGSFSTEETKQFHATHGCGVF
FT                   ASFGAFKWQRGVSGDSSLFGISSPDPVRLAQLKGYEYERNIVLENTANFLDGISANNML
FT                   LYGDRGTGKSSTVKAVFNEFRGRGLRIIEVSKDCIVEFARIIERIGSVPLKFIIFIDDL
FT                   SFSDDDDNYSALKAVLEGGVAARPRNTVIYATSNRRHFVKESFSERDSEIHAGDAMQEK
FT                   LSLADRFGITVTFTSPDQRLYFDIVRALAADRGLDVDGAQLERGAAQWALRYNGRSPRT
FT                   ATQYIDWVAGRIKKGLPLDDF"
     MDTVQKARLA LSSLGLYRPL LEKPVVAAFA KVLETAHGAE LRGFLDAYGA FISLLAPARA        60
     TAGVLDFSGA LHTLVQQNDS LFARQAAAGR VEEAVRAAAA RDLEALSMAL DLSPREIKAA       120
     ASASFDDDDS VAFIDSLPDF ITGGSFSTEE TKQFHATHGC GVFASFGAFK WQRGVSGDSS       180
     LFGISSPDPV RLAQLKGYEY ERNIVLENTA NFLDGISANN MLLYGDRGTG KSSTVKAVFN       240
     EFRGRGLRII EVSKDCIVEF ARIIERIGSV PLKFIIFIDD LSFSDDDDNY SALKAVLEGG       300
     VAARPRNTVI YATSNRRHFV KESFSERDSE IHAGDAMQEK LSLADRFGIT VTFTSPDQRL       360
     YFDIVRALAA DRGLDVDGAQ LERGAAQWAL RYNGRSPRTA TQYIDWVAGR IKKGLPLDDF       420
//

If you have problems or comments...

PBIL Back to PBIL home page