(data stored in ACNUC9435 zone)

EMBL: CP002400.PE179

CP002400.PE179       Location/Qualifiers
FT   CDS             192812..193804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0183"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; KEGG:
FT                   cpy:Cphy_3020 ketol-acid reductoisomerase; PFAM:
FT                   Acetohydroxy acid isomeroreductase catalytic
FT                   domain-containing protein; acetohydroxy acid
FT                   isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25770"
FT                   /db_xref="GOA:E6U6N7"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N7"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ADU25770.1"
FT                   /translation="MAKMYYESDCNISLLKGKKIAIIGYGSQGHAHALNLNESGIDVIV
FT                   GLYKGSRSWHVAEAAGLTVMTAAEAAAEADIIMILINDEKQAAMYEKDIAPNLTEGKAL
FT                   AFAHGFNIHFGQIVPPKNVDVFMVAPKAPGHTVRSEYLRGAGTPCLIAVEQDHSGKTKE
FT                   IALAYAAGIGGARAGILETTFRVETETDLFGEQAVLCGGVTALMQAGFETLVEAGYAPE
FT                   NAYFECIHEMKLIVDLIYAGGFEAMRKSISDTAEYGDYITGPKIITDETRKAMKDVLKD
FT                   IQEGKFAREWILENRVGRPNFNALRRKGAEAQLVEVGQQLRSQMTFLKK"
     MAKMYYESDC NISLLKGKKI AIIGYGSQGH AHALNLNESG IDVIVGLYKG SRSWHVAEAA        60
     GLTVMTAAEA AAEADIIMIL INDEKQAAMY EKDIAPNLTE GKALAFAHGF NIHFGQIVPP       120
     KNVDVFMVAP KAPGHTVRSE YLRGAGTPCL IAVEQDHSGK TKEIALAYAA GIGGARAGIL       180
     ETTFRVETET DLFGEQAVLC GGVTALMQAG FETLVEAGYA PENAYFECIH EMKLIVDLIY       240
     AGGFEAMRKS ISDTAEYGDY ITGPKIITDE TRKAMKDVLK DIQEGKFARE WILENRVGRP       300
     NFNALRRKGA EAQLVEVGQQ LRSQMTFLKK                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page