(data stored in ACNUC9435 zone)

EMBL: CP002400.PE18

CP002400.PE18        Location/Qualifiers
FT   CDS             20724..21491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0018"
FT                   /product="Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulfur cluster binding domain"
FT                   /note="PFAM: Dihydroorotate dehydrogenase, electron
FT                   transfer subunit, iron-sulphur cluster binding domain;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Oxidoreductase FAD-binding domain protein; KEGG:
FT                   amt:Amet_4209 oxidoreductase FAD/NAD(P)-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25609"
FT                   /db_xref="GOA:E6U5E2"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E2"
FT                   /inference="protein motif:PFAM:PF10418"
FT                   /protein_id="ADU25609.1"
FT                   /translation="MTISALPCPVLSRENIAAGVYDVWLSAPQAEQAKPGQFVGVRCEG
FT                   FTLRRPVSICEIDRARGRLRLIFEERGEGTRWMTSVRVGETMDLLAPLGNGFNLGDAGR
FT                   AAVFVGGGIGVPPLLEAAKPFAGHADAILGFRSKPNVILKADFERFGAHVTVVTQDGTE
FT                   GETGVVTPPLEKRLDSAPCGVIFACGPRPMLAAVAGVAEARGIPCFVSMEARMACGVGA
FT                   CLSCAIPVKVGNEVQNWHVCKNGPVFDAARIVW"
     MTISALPCPV LSRENIAAGV YDVWLSAPQA EQAKPGQFVG VRCEGFTLRR PVSICEIDRA        60
     RGRLRLIFEE RGEGTRWMTS VRVGETMDLL APLGNGFNLG DAGRAAVFVG GGIGVPPLLE       120
     AAKPFAGHAD AILGFRSKPN VILKADFERF GAHVTVVTQD GTEGETGVVT PPLEKRLDSA       180
     PCGVIFACGP RPMLAAVAGV AEARGIPCFV SMEARMACGV GACLSCAIPV KVGNEVQNWH       240
     VCKNGPVFDA ARIVW                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page