(data stored in ACNUC9435 zone)

EMBL: CP002400.PE180

CP002400.PE180       Location/Qualifiers
FT   CDS             complement(193879..194502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0184"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: kol:Kole_1528
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25771"
FT                   /db_xref="GOA:E6U6N8"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N8"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADU25771.1"
FT                   /translation="MQGQSGCPVQRRPLCCLDGRLPVGGCILTCQTGRSGLYYKEMQHP
FT                   AHGIARRAGQERGVALEKPHKETRNTKQKQLILDCMKNAGGAHMTAEEIYNRIRQESQT
FT                   ISIATVYRNLRLLEENGTVKKVYVADDSLAYYEMSDAQSPHAHHHLVCRKCGAILDFEA
FT                   DLLDGLERLIESTKHFQIEDHRVVFYGVCEACRRRDGENAQPRK"
     MQGQSGCPVQ RRPLCCLDGR LPVGGCILTC QTGRSGLYYK EMQHPAHGIA RRAGQERGVA        60
     LEKPHKETRN TKQKQLILDC MKNAGGAHMT AEEIYNRIRQ ESQTISIATV YRNLRLLEEN       120
     GTVKKVYVAD DSLAYYEMSD AQSPHAHHHL VCRKCGAILD FEADLLDGLE RLIESTKHFQ       180
     IEDHRVVFYG VCEACRRRDG ENAQPRK                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page