(data stored in ACNUC9435 zone)

EMBL: CP002400.PE184

CP002400.PE184       Location/Qualifiers
FT   CDS             199244..199750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0188"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; KEGG: cce:Ccel_2185
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25775"
FT                   /db_xref="GOA:E6U6P2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P2"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ADU25775.1"
FT                   /translation="MQELKKVAVIMGSDSDLPVVKGCLTTLKEFGVPFEVHVCSAHRTP
FT                   GKAAAFAKSAAENGFGVLIAAAGMAAHLAGAMAAQSVLPVIGIPVKSAAFGGLDALLST
FT                   VQMPSGIPVATVAVDGAKNAAFLSIQILALGNAELTQKLLDYKQSMADGVEKKDMALQT
FT                   EVEKL"
     MQELKKVAVI MGSDSDLPVV KGCLTTLKEF GVPFEVHVCS AHRTPGKAAA FAKSAAENGF        60
     GVLIAAAGMA AHLAGAMAAQ SVLPVIGIPV KSAAFGGLDA LLSTVQMPSG IPVATVAVDG       120
     AKNAAFLSIQ ILALGNAELT QKLLDYKQSM ADGVEKKDMA LQTEVEKL                    168
//

If you have problems or comments...

PBIL Back to PBIL home page