(data stored in ACNUC9435 zone)

EMBL: CP002400.PE194

CP002400.PE194       Location/Qualifiers
FT   CDS             209090..210349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0198"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; KEGG:
FT                   cth:Cthe_1245 phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25785"
FT                   /db_xref="GOA:E6U6Q2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q2"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADU25785.1"
FT                   /translation="MDILVIGGGGREHAVIKKLKESPRAGAIYCAPGNGGIAADARCVP
FT                   IKATDVDGVVRFAKDNRIGFVVVTPDDPLALGMVDALEAAGIKAFGPNQAAAAIESSKV
FT                   FSKNLMKKYGIPTAAYDVFESPIEALAHIVKEGRYPAVIKADGLALGKGVVIAQNEDEA
FT                   RAALHAIMEDKIFGASGNRVVVEEFLTGPEVSVLAFTDGKTIRPMVSSKDHKRALDGDK
FT                   GPNTGGMGTISPNPHYTDTIADQCMETIFLPTVHAMNAEGRPFKGCLYFGLMLTPDGPK
FT                   VIEYNARFGDPETQVVLLRLQSDLLDILEAVADERLAGMDIEWDSRAAACVVAASGGYP
FT                   GKYASGKAITGIAAAETHPDVTVFHAGTRLEDGTLVTAGGRVLGVTALGATLEQALGIA
FT                   YAALREIHFDGMQFRTDIGR"
     MDILVIGGGG REHAVIKKLK ESPRAGAIYC APGNGGIAAD ARCVPIKATD VDGVVRFAKD        60
     NRIGFVVVTP DDPLALGMVD ALEAAGIKAF GPNQAAAAIE SSKVFSKNLM KKYGIPTAAY       120
     DVFESPIEAL AHIVKEGRYP AVIKADGLAL GKGVVIAQNE DEARAALHAI MEDKIFGASG       180
     NRVVVEEFLT GPEVSVLAFT DGKTIRPMVS SKDHKRALDG DKGPNTGGMG TISPNPHYTD       240
     TIADQCMETI FLPTVHAMNA EGRPFKGCLY FGLMLTPDGP KVIEYNARFG DPETQVVLLR       300
     LQSDLLDILE AVADERLAGM DIEWDSRAAA CVVAASGGYP GKYASGKAIT GIAAAETHPD       360
     VTVFHAGTRL EDGTLVTAGG RVLGVTALGA TLEQALGIAY AALREIHFDG MQFRTDIGR        419
//

If you have problems or comments...

PBIL Back to PBIL home page