(data stored in ACNUC9435 zone)

EMBL: CP002400.PE196

CP002400.PE196       Location/Qualifiers
FT   CDS             211311..211991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0200"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG:
FT                   eel:EUBELI_20176 alpha-ribazole phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25787"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q4"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADU25787.1"
FT                   /translation="MKAYHIYLIRHGITQGNDEGRYIGSTDQPLSARGEQELKKLAGSY
FT                   RYPDAEAFYTSPLQRCARTLEILYPDVSPRVVPDLRECDFGDYENKSMDDLKDDPGYQK
FT                   WVAAKGGITPPNGESVEIFQKRCCAAFAGIVNELLRAGTTRAVVCAHGGTIMFILAAFG
FT                   YPKYPFYRWMTGNGLGYEIVITPQLWMSAQAFDIAAPIPENAPDTGLSGLQSVMDALKQ
FT                   NSEN"
     MKAYHIYLIR HGITQGNDEG RYIGSTDQPL SARGEQELKK LAGSYRYPDA EAFYTSPLQR        60
     CARTLEILYP DVSPRVVPDL RECDFGDYEN KSMDDLKDDP GYQKWVAAKG GITPPNGESV       120
     EIFQKRCCAA FAGIVNELLR AGTTRAVVCA HGGTIMFILA AFGYPKYPFY RWMTGNGLGY       180
     EIVITPQLWM SAQAFDIAAP IPENAPDTGL SGLQSVMDAL KQNSEN                      226
//

If you have problems or comments...

PBIL Back to PBIL home page