(data stored in ACNUC9435 zone)

EMBL: CP002400.PE20

CP002400.PE20        Location/Qualifiers
FT   CDS             22787..23452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0020"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: csc:Csac_1937
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25611"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E4"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADU25611.1"
FT                   /translation="MTRIYLIRHAEAEGNLRRIFQGHTDADISTNGQRQLERLSERFEP
FT                   VHLDALYASPLKRAYKTAQAVDAVRHLPIITLEGLMEINGGCWEGKPWAKLPALYPQDN
FT                   DAWENRPWDFAPAGGEPMRQVYARMWETLGGIARRHPGKTVGVASHGCAIRNYLCQAHG
FT                   WPIERLGEVGWCDNTAVSIIEYREGGQVTITMENDASHLDDELSTVAKQDWWRRSTRA"
     MTRIYLIRHA EAEGNLRRIF QGHTDADIST NGQRQLERLS ERFEPVHLDA LYASPLKRAY        60
     KTAQAVDAVR HLPIITLEGL MEINGGCWEG KPWAKLPALY PQDNDAWENR PWDFAPAGGE       120
     PMRQVYARMW ETLGGIARRH PGKTVGVASH GCAIRNYLCQ AHGWPIERLG EVGWCDNTAV       180
     SIIEYREGGQ VTITMENDAS HLDDELSTVA KQDWWRRSTR A                           221
//

If you have problems or comments...

PBIL Back to PBIL home page