(data stored in ACNUC9435 zone)

EMBL: CP002400.PE22

CP002400.PE22        Location/Qualifiers
FT   CDS             23867..25282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0022"
FT                   /product="RNA methylase, NOL1/NOP2/sun family"
FT                   /note="KEGG: hmo:HM1_1033 nol1/nop2/sun family putative RNA
FT                   methylase; TIGRFAM: RNA methylase, NOL1/NOP2/sun family;
FT                   PFAM: Fmu (Sun) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25613"
FT                   /db_xref="GOA:E6U5E6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR027391"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031340"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E6"
FT                   /inference="protein motif:TFAM:TIGR00446"
FT                   /protein_id="ADU25613.1"
FT                   /translation="MAKRKARPPVPQAVPPAAFLARMRGLLGEADFAAFEAAQTAPVRR
FT                   GLRLNLLKCRDASAFARIAGFSLSPLPFSPEGFSVEGGDVSGRHPWHHAGVFYLQEPSA
FT                   MSAVTALDPRPGQRVLDLCAAPGGKSTQIAARLGGQGLLVANEIVPGRAKILLSNLERF
FT                   GVRNACVYNETPERLCAAFPGFFDAVLVDAPCSGEGMFRREPAAAAEWTPETPAACARR
FT                   QRAILDWAKTALRPGGVLVYSTCTFAPEENECVVAAFLKENPDFSMEPIPCAFGRPARP
FT                   DWGGGEPSLELARRIFPQDGGEGHFVARLRMGAGAAAGTARFHAQENGDGMDDAQADVL
FT                   LRAFFAEQFGEPPYGRPHAAGEVLFLLPEELPALPQGLRLLRAGVCAGRIKSGRFEPTH
FT                   ALYLAAAPGACRRAVDLPLGDARLAAFLHGEQIEADGAAGYIAVLAAGHAVGFGKASGG
FT                   VLKNHYPRALRTL"
     MAKRKARPPV PQAVPPAAFL ARMRGLLGEA DFAAFEAAQT APVRRGLRLN LLKCRDASAF        60
     ARIAGFSLSP LPFSPEGFSV EGGDVSGRHP WHHAGVFYLQ EPSAMSAVTA LDPRPGQRVL       120
     DLCAAPGGKS TQIAARLGGQ GLLVANEIVP GRAKILLSNL ERFGVRNACV YNETPERLCA       180
     AFPGFFDAVL VDAPCSGEGM FRREPAAAAE WTPETPAACA RRQRAILDWA KTALRPGGVL       240
     VYSTCTFAPE ENECVVAAFL KENPDFSMEP IPCAFGRPAR PDWGGGEPSL ELARRIFPQD       300
     GGEGHFVARL RMGAGAAAGT ARFHAQENGD GMDDAQADVL LRAFFAEQFG EPPYGRPHAA       360
     GEVLFLLPEE LPALPQGLRL LRAGVCAGRI KSGRFEPTHA LYLAAAPGAC RRAVDLPLGD       420
     ARLAAFLHGE QIEADGAAGY IAVLAAGHAV GFGKASGGVL KNHYPRALRT L                471
//

If you have problems or comments...

PBIL Back to PBIL home page