(data stored in ACNUC9435 zone)

EMBL: CP002400.PE221

CP002400.PE221       Location/Qualifiers
FT   CDS             235279..236100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0225"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: bln:Blon_2207 transglutaminase, N-terminal
FT                   domain protein; PFAM: transglutaminase domain-containing
FT                   protein; SMART: transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25812"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S9"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADU25812.1"
FT                   /translation="MKRFSFEYRSSIRFSQPVKAHHFRLKCLPGRFAFQHIYHECCAFA
FT                   GGITPLEGADAFGNRTLAGTIAEPHDLFAFTVSGEALQSFYLLREPLDDLFLYESPLTH
FT                   MSGAMEAFAQTIPGGGTAAKQASAVCKALQARLTYLPASTDVDMPAADAFAQGKGVCQD
FT                   YAQIAVALLRGRGIPARYCAGLMPGEGETHAWVEYYDGGAWHGIDPTNDRAIDYGYIKL
FT                   SHGRDSADCRVDRGCFVGPAEQVEQTLEIHVKVGEQCDQESGNGQPDLPAR"
     MKRFSFEYRS SIRFSQPVKA HHFRLKCLPG RFAFQHIYHE CCAFAGGITP LEGADAFGNR        60
     TLAGTIAEPH DLFAFTVSGE ALQSFYLLRE PLDDLFLYES PLTHMSGAME AFAQTIPGGG       120
     TAAKQASAVC KALQARLTYL PASTDVDMPA ADAFAQGKGV CQDYAQIAVA LLRGRGIPAR       180
     YCAGLMPGEG ETHAWVEYYD GGAWHGIDPT NDRAIDYGYI KLSHGRDSAD CRVDRGCFVG       240
     PAEQVEQTLE IHVKVGEQCD QESGNGQPDL PAR                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page